PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK24240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 275aa    MW: 31217.8 Da    PI: 8.8427
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK24240.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.92.5e-50451702128
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101
                +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++ +g
  PK24240.1  45 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRTESSRSIG 143
                79***************************.89***************8778899********************************************** PP

        NAM 102 lkktLvfykgrapkgektdWvmheyrl 128
                lkktLvfy+g+apkg +t+W+m+eyrl
  PK24240.1 144 LKKTLVFYSGKAPKGIRTSWIMNEYRL 170
                *************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-5644191IPR003441NAC domain
PROSITE profilePS5100555.73244191IPR003441NAC domain
PfamPF023652.3E-2546170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MAIAGTSSST TTASNNMSQE NESSNNNVVS KANDDDDDHE HDVVMPGFRF HPTEEELVEF  60
YLRRKVEGKR FNVELITFLD LYRYDPWELP ALAAIGEKEW FFYVPRDRKY RNGDRPNRVT  120
TSGYWKATGA DRMIRTESSR SIGLKKTLVF YSGKAPKGIR TSWIMNEYRL PQHETERYQK  180
AEISLCRVYK RPGVEDHPSL PRSLPSRASS SSRAAHLVDR KQQPVNAMEK IGQAFMGQPT  240
ALPQQFEQEN MNETDGSSSS DVAGGNILGV SKRKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-574619119165NO APICAL MERISTEM PROTEIN
1ut4_B3e-574619119165NO APICAL MERISTEM PROTEIN
1ut7_A3e-574619119165NO APICAL MERISTEM PROTEIN
1ut7_B3e-574619119165NO APICAL MERISTEM PROTEIN
3swm_A5e-574619122168NAC domain-containing protein 19
3swm_B5e-574619122168NAC domain-containing protein 19
3swm_C5e-574619122168NAC domain-containing protein 19
3swm_D5e-574619122168NAC domain-containing protein 19
3swp_A5e-574619122168NAC domain-containing protein 19
3swp_B5e-574619122168NAC domain-containing protein 19
3swp_C5e-574619122168NAC domain-containing protein 19
3swp_D5e-574619122168NAC domain-containing protein 19
4dul_A3e-574619119165NAC domain-containing protein 19
4dul_B3e-574619119165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088702.11e-138Putative NAC domain-containing protein 94
SwissprotQ9FIW51e-63NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLW9R2891e-138W9R289_9R
STRINGGLYMA17G00650.21e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-109NAC domain containing protein 35